PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.18742s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NF-YC
Protein Properties Length: 203aa    MW: 23345.8 Da    PI: 8.0094
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.18742s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC97.31.2e-3058151296
                 NF-YC   2 lksfwekqiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifd 90 
                           l++fw++q  +    k+ +lPla +k+++k+d++vkm+s + Pvll+ka e+fi e+tlr+w ++++ +r+t++ +di++a+ +++i+d
  Cagra.18742s0003.1.p  58 LEMFWAHQNSSG-LHKKPDLPLATVKRVMKSDPNVKMVSWKGPVLLAKASEMFIQEVTLRAWRQTQSRSRTTIRSCDIHEALRSSVIYD 145
                           789***996654.56889*********************************************************************** PP

                 NF-YC  91 flvdiv 96 
                            lv+  
  Cagra.18742s0003.1.p 146 ELVNLL 151
                           999865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.6E-2271138IPR009072Histone-fold
SuperFamilySSF471136.13E-1974156IPR009072Histone-fold
PfamPF008083.3E-1576138IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MVKPVIVTSS LIPNPSMQET CSMNEHREPS TRSLTQSSDQ RRPFCPAHRE RDLLNQDLEM  60
FWAHQNSSGL HKKPDLPLAT VKRVMKSDPN VKMVSWKGPV LLAKASEMFI QEVTLRAWRQ  120
TQSRSRTTIR SCDIHEALRS SVIYDELVNL LSVEQCFVNH PGVQPQGTTH QQMLPPENVN  180
EPNMKVPIDI DQIQQVYQFM FLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_C2e-185815119117HapE
4g92_C2e-185815119117HapE
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292519.11e-135hypothetical protein CARUB_v10018749mg
TrEMBLR0FRW41e-135R0FRW4_9BRAS; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_70033622e-69(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1910667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G38140.13e-26nuclear factor Y, subunit C12